Loading...
Statistics
Advertisement

Judith Bieletto - Home
www.judithbieletto.com/

Judithbieletto.com

Advertisement
Conversion Technology Metas Server
Judithbieletto.com is hosted in United States / San Francisco . Judithbieletto.com uses HTTPS protocol. Number of used technologies: 4. First technologies: CSS, Html, Html5, Number of used javascripts: 6. First javascripts: Jquery.min.js, Jquery_effects.js, Jquery.animate.js, Number of used analytics tools: 2. First analytics tools: Google Analytics, Quantcast Measurement, Its server type is: Apache.

Technologies in use by Judithbieletto.com

Technology

Number of occurences: 4
  • CSS
  • Html
  • Html5
  • Javascript

Advertisement

Javascripts

Number of occurences: 6
  • jquery.min.js
  • jquery_effects.js
  • jquery.animate.js
  • fancybox.min.js
  • utilities-jq.js
  • flyout_menus_jq.js

Analytics

Number of occurences: 2
  • Google Analytics
  • Quantcast Measurement

Server Type

  • Apache

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Judithbieletto.com

SSL certificate

    • name: /1.3.6.1.4.1.311.60.2.1.3=US/1.3.6.1.4.1.311.60.2.1.2=Delaware/businessCategory=Private Organization/serialNumber=4277212/C=US/ST=California/L=San Francisco/O=Weebly, Inc./CN=www.weebly.com
    • subject:
      • UNDEF:
        • 0: US
        • 1: Delaware
      • businessCategory: Private Organization
      • serialNumber: 4277212
      • C: US
      • ST: California
      • L: San Francisco
      • O: Weebly, Inc.
      • CN: www.weebly.com
    • hash: f057e67f
    • issuer:
      • C: US
      • O: GeoTrust Inc.
      • CN: GeoTrust EV SSL CA - G4
    • version: 2
    • serialNumber: 43413283103021725306269212607996199514
    • validFrom: 160809000000Z
    • validTo: 180803235959Z
    • validFrom_time_t: 1470700800
    • validTo_time_t: 1533340799
    • extensions:
      • subjectAltName: DNS:www-alt.weebly.com, DNS:secure.weebly.com, DNS:studio.weebly.com, DNS:promote.weebly.com, DNS:mobileapi.weebly.com, DNS:www.weebly.com, DNS:weebly.com
      • basicConstraints: CA:FALSE
      • keyUsage: Digital Signature, Key Encipherment
      • crlDistributionPoints: Full Name: URI:http://gm.symcb.com/gm.crl
      • certificatePolicies: Policy: 1.3.6.1.4.1.14370.1.6 CPS: https://www.geotrust.com/resources/repository/legal User Notice: Explicit Text: https://www.geotrust.com/resources/repository/legal Policy: 2.23.140.1.1
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • authorityKeyIdentifier: keyid:DE:CF:5C:50:B7:AE:02:1F:15:17:AA:16:E8:0D:B5:28:9D:6A:5A:F3
      • authorityInfoAccess: OCSP - URI:http://gm.symcd.com CA Issuers - URI:http://gm.symcb.com/gm.crt
      • 1.3.6.1.4.1.11129.2.4.2: ‚igvÝë+z O¦ ‹­hp~.ŽÕ\ˆ=ÄͶì¾ÌVqâG0E!º£ûp§ý¢üª"ž¡å×j¦*¾I˜²iµ I|ì !IÇ>ÜD$¾ìÉý”¨<ªié-|”èjµµ³†oŸÓ¶v¤¹ ´X‡»¢Ìgp <5˜ù߸ãwÍÈ ÜVqâHG0E!¸ÓPôj,•}©rѤi,p±¼×uî¸Sª*¤ÏQÀ +ö@ åË£óÏœ²?~÷ì;°©@aÏ"¿Ò>‹ æ|uhö˜ød‚¾:Œî¹(LüqQ]g“ÔDÑ g¬»OOûÄVqâ=F0D (½Ñsr­Èn*b=}+é4¢¦dFB%Ÿ¤¿B1™~ %¬ò³mbór¤ü6¢ž‘¬äƒÐYoÔO0U<,Ð…Ò

Meta - Judithbieletto.com

Number of occurences: 2
  • Name:
    Content: text/html; charset=utf-8
  • Name: google-site-verification
    Content: cBiKf3dRBJdX062GP4EVuyeloyx8KFvIpR-eMsG10w4

Server / Hosting

  • IP: 199.34.228.46
  • Latitude: 37.77
  • Longitude: -122.39
  • Country: United States
  • City: San Francisco

Rname

  • dns162.b.register.com
  • dns127.c.register.com
  • dns082.d.register.com
  • dns121.a.register.com
  • alt1.aspmx.l.google.com
  • aspmx4.googlemail.com
  • aspmx2.googlemail.com
  • alt2.aspmx.l.google.com
  • aspmx3.googlemail.com
  • aspmx5.googlemail.com
  • aspmx.l.google.com

Target

  • root.register.com

HTTP Header Response

HTTP/1.1 200 OK Date: Tue, 30 Aug 2016 03:15:21 GMT Server: Apache Set-Cookie: is_mobile=0; path=/; domain=www.judithbieletto.com Accept-Ranges: bytes Vary: Accept-Encoding,User-Agent X-Host: pages19.sf2p.intern.weebly.net Pragma: no-cache Cache-Control: no-cache, no-store, max-age=0, must-revalidate Expires: -1 Content-Length: 12811 Content-Type: text/html; charset=UTF-8 X-W-DC: SFO X-Cache: MISS from s_mf40 X-Cache-Lookup: MISS from s_mf40:80 Via: 1.1 s_mf40 (squid/3.5.20) Connection: keep-alive

DNS

host: judithbieletto.com
  1. class: IN
  2. ttl: 3600
  3. type: A
  4. ip: 199.34.228.46
host: judithbieletto.com
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: dns162.b.register.com
host: judithbieletto.com
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: dns127.c.register.com
host: judithbieletto.com
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: dns082.d.register.com
host: judithbieletto.com
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: dns121.a.register.com
host: judithbieletto.com
  1. class: IN
  2. ttl: 3600
  3. type: SOA
  4. mname: dns121.a.register.com
  5. rname: root.register.com
  6. serial: 2011121202
  7. refresh: 28800
  8. retry: 7200
  9. expire: 604800
  10. minimum-ttl: 3600
host: judithbieletto.com
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 20
  5. target: alt1.aspmx.l.google.com
host: judithbieletto.com
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 30
  5. target: aspmx4.googlemail.com
host: judithbieletto.com
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 30
  5. target: aspmx2.googlemail.com
host: judithbieletto.com
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 20
  5. target: alt2.aspmx.l.google.com
host: judithbieletto.com
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 30
  5. target: aspmx3.googlemail.com
host: judithbieletto.com
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 30
  5. target: aspmx5.googlemail.com
host: judithbieletto.com
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 10
  5. target: aspmx.l.google.com

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.udithbieletto.com, www.jzudithbieletto.com, www.zudithbieletto.com, www.jhudithbieletto.com, www.hudithbieletto.com, www.jnudithbieletto.com, www.nudithbieletto.com, www.j.udithbieletto.com, www..udithbieletto.com, www.juudithbieletto.com, www.uudithbieletto.com, www.jkudithbieletto.com, www.kudithbieletto.com, www.jludithbieletto.com, www.ludithbieletto.com, www.joudithbieletto.com, www.oudithbieletto.com, www.jdithbieletto.com, www.juwdithbieletto.com, www.jwdithbieletto.com, www.juedithbieletto.com, www.jedithbieletto.com, www.jusdithbieletto.com, www.jsdithbieletto.com, www.juadithbieletto.com, www.jadithbieletto.com, www.juithbieletto.com, www.judtithbieletto.com, www.jutithbieletto.com, www.judgithbieletto.com, www.jugithbieletto.com, www.judbithbieletto.com, www.jubithbieletto.com, www.judxithbieletto.com, www.juxithbieletto.com, www.judsithbieletto.com, www.jusithbieletto.com, www.judfithbieletto.com, www.jufithbieletto.com, www.judvithbieletto.com, www.juvithbieletto.com, www.judyithbieletto.com, www.juyithbieletto.com, www.judzithbieletto.com, www.juzithbieletto.com, www.judaithbieletto.com, www.juaithbieletto.com, www.judeithbieletto.com, www.jueithbieletto.com, www.judrithbieletto.com, www.jurithbieletto.com, www.judthbieletto.com, www.judirthbieletto.com, www.judrthbieletto.com, www.judifthbieletto.com, www.judfthbieletto.com, www.judivthbieletto.com, www.judvthbieletto.com, www.judikthbieletto.com, www.judkthbieletto.com, www.judi,thbieletto.com, www.jud,thbieletto.com, www.judibthbieletto.com, www.judbthbieletto.com, www.judigthbieletto.com, www.judgthbieletto.com, www.juditthbieletto.com, www.judtthbieletto.com, www.judiythbieletto.com, www.judythbieletto.com, www.judiuthbieletto.com, www.juduthbieletto.com, www.judijthbieletto.com, www.judjthbieletto.com, www.judimthbieletto.com, www.judmthbieletto.com, www.judinthbieletto.com, www.judnthbieletto.com, www.judihbieletto.com, www.juditqhbieletto.com, www.judiqhbieletto.com, www.juditahbieletto.com, www.judiahbieletto.com, www.judit hbieletto.com, www.judi hbieletto.com, www.juditwhbieletto.com, www.judiwhbieletto.com, www.juditehbieletto.com, www.judiehbieletto.com, www.juditzhbieletto.com, www.judizhbieletto.com, www.juditxhbieletto.com, www.judixhbieletto.com, www.juditchbieletto.com, www.judichbieletto.com, www.juditbieletto.com, www.judithebieletto.com, www.juditebieletto.com, www.judithdbieletto.com, www.juditdbieletto.com, www.judithcbieletto.com, www.juditcbieletto.com, www.judithubieletto.com, www.juditubieletto.com, www.judithjbieletto.com, www.juditjbieletto.com, www.judithbieletto.com, www.juditbieletto.com, www.judithbbieletto.com, www.juditbbieletto.com, www.judithgbieletto.com, www.juditgbieletto.com, www.judithieletto.com, www.judithbqieletto.com, www.judithqieletto.com, www.judithbwieletto.com, www.judithwieletto.com, www.judithbzieletto.com, www.judithzieletto.com, www.judithbxieletto.com, www.judithxieletto.com, www.judithbieletto.com, www.judithieletto.com, www.judithbsieletto.com, www.judithsieletto.com, www.judithbyieletto.com, www.judithyieletto.com, www.judithbeieletto.com, www.juditheieletto.com, www.judithbdieletto.com, www.judithdieletto.com, www.judithbcieletto.com, www.judithcieletto.com, www.judithbeletto.com, www.judithbireletto.com, www.judithbreletto.com, www.judithbifeletto.com, www.judithbfeletto.com, www.judithbiveletto.com, www.judithbveletto.com, www.judithbikeletto.com, www.judithbkeletto.com, www.judithbi,eletto.com, www.judithb,eletto.com, www.judithbibeletto.com, www.judithbbeletto.com, www.judithbigeletto.com, www.judithbgeletto.com, www.judithbiteletto.com, www.judithbteletto.com, www.judithbiyeletto.com, www.judithbyeletto.com, www.judithbiueletto.com, www.judithbueletto.com, www.judithbijeletto.com, www.judithbjeletto.com, www.judithbimeletto.com, www.judithbmeletto.com, www.judithbineletto.com, www.judithbneletto.com,

Other websites we recently analyzed

  1. njchildcustodyexpert.com
    Scottsdale (United States) - 50.63.202.44
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe, Php
  2. clever-mario.INFO
    Germany - 82.165.250.5
    Server software: Apache
    Technology: Html
    Number of meta tags: 3
  3. Softshell jassen voor dames, heren en kinderen | SoftshellWebshop.nl
    Softshell jassen voor dames, heren en kinderen. Ontdek de nieuwe zomercollectie 2016! ✓ Ook grote maten. Koop uw softshell jack online: gratis verzending.
    Netherlands - 5.61.248.217
    Server software: Apache/2
    Technology: CSS, Cufon, Html, Javascript, jQuery Cycle, Zopim Live Chat, Clicky Web Analytics, Google Analytics, Magento
    Number of Javascript: 21
    Number of meta tags: 4
  4. plantspearlsparanoia | Growing Seedlings & Other Thoughts
    Provo (United States) - 173.254.14.138
    Server software: nginx/1.8.1
    Technology: CSS, Html, Html5, Javascript, Php, Pingback, Wordpress
    Number of Javascript: 1
    Number of meta tags: 2
  5. designertobuyers.com
    Scottsdale (United States) - 50.63.202.44
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  6. SeaMODE Speed Lab
    Gloucester (United Kingdom) - 213.171.218.7
    G Analytics ID: UA-79673652-1
    Server software: nginx
    Technology: CSS, Html, Javascript, Google Analytics
    Number of meta tags: 1
  7. HostingDiscounter De goedkoopste webhoster van nederland
    HostingDiscounter De goedkoopste webhoster van Nederland - Goedkope domeinnaam registratie, Domein hosting met veel diskspace op uw shared of dedicated server
    Netherlands - 77.95.252.42
    Server software: Apache/2.2.22 (Ubuntu)
    Technology: Html, Javascript
    Number of Javascript: 1
    Number of meta tags: 5
  8. Home | Hoveniersbedrijf Slaats | Hovenier, Deurne, Fred Slaats
    Hoveniersbedrijf uit Neerkant bij Deurne, werkzaam in de gehele regio van Noord-Brabant en Limburg. Onze specialiteit is onderhoud en snoeiwerk.
    Netherlands - 149.210.237.177
    Server software: Apache
    Technology: AJAX Libraries API, CSS, Html, Javascript, Add This
    Number of Javascript: 2
    Number of meta tags: 2
  9. Welcome to Gehlin.Com!
    Sweden - 213.180.93.13
    Server software: Apache/2.2.22 (Ubuntu)
    Technology: CSS, Html
    Number of meta tags: 1
  10. tampacriminaldefenselawyer.net
    Wayne (United States) - 216.250.120.114
    Server software: Apache
    Technology: Html
    Number of meta tags: 1

Check Other Websites